PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G14480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 332aa    MW: 32584.2 Da    PI: 7.0726
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G14480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.52e-30111164155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  OPUNC05G14480.1 111 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 164
                      59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.63E-20108168IPR009057Homeodomain-like
PROSITE profilePS5129411.059108167IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-30110169IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-24112164IPR006447Myb domain, plants
PfamPF002491.3E-7114163IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MREEEEPSWF ARWEEQLPAP DELMPLSQSL ITPDLAVAFD IPTHGGGGGG GGGVGGGVVG  60
GDGVGGGGGG GGGGGGGVGA GEMNGGASSA AGSSGGGGGG GGDEPARTLK RPRLVWTPQL  120
HKRFVDAVAH LGIKNAVPKT IMQLMSVDGL TRENVASHLQ KYRLYLKRMQ GVGNGGGGGG  180
GGGGGAGGSH SSGSGTDAAT EHLFATGPVP FLPPGRAPAG GDPYPPFAPM AAHHHHHPSQ  240
ISHFHHPAAR PLGHYGSGPG AGFDHGFLSR AVAGGGPPVG PPGMHHRMVG GGAGMAMMAP  300
SPFAEELELG SRGGGGGGGR RELTLFPTSG DH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-21110169463ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1311319RGGGGGGGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1306070.0AC130607.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0017D10, complete sequence.
GenBankAC1307290.0AC130729.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0668F02, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640251.11e-143PREDICTED: transcription factor PCL1-like
TrEMBLA0A0E0L2I60.0A0A0E0L2I6_ORYPU; Uncharacterized protein
STRINGBGIOSGA018058-PA1e-142(Oryza sativa Indica Group)
STRINGLOC_Os05g34110.11e-142(Oryza sativa Japonica Group)
STRINGORGLA05G0141400.11e-142(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.14e-52G2-like family protein